PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C009874P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 314aa    MW: 35077.1 Da    PI: 6.5114
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C009874P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.72.3e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd  lv +++q+G+g+W+++++  g+ R+ k+c++rw +yl
   MELO3C009874P1 14 KGPWTPEEDIVLVSYIQQHGPGNWRAVPANTGLLRCSKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding50.26.1e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T  E++ +v++ ++lG++ W++Ia++++  Rt++++k++w+++l
   MELO3C009874P1  67 RGNFTHHEEKMIVHLQALLGNR-WAAIASYLP-QRTDNDIKNHWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.0E-24564IPR009057Homeodomain-like
PROSITE profilePS5129424.244965IPR017930Myb domain
SuperFamilySSF466891.36E-3011108IPR009057Homeodomain-like
SMARTSM007171.1E-131363IPR001005SANT/Myb domain
PfamPF002491.4E-151461IPR001005SANT/Myb domain
CDDcd001677.23E-111661No hitNo description
Gene3DG3DSA:1.10.10.601.1E-2365116IPR009057Homeodomain-like
PROSITE profilePS5129419.30566116IPR017930Myb domain
SMARTSM007171.6E-1466114IPR001005SANT/Myb domain
PfamPF002495.7E-1467112IPR001005SANT/Myb domain
CDDcd001673.50E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MGRPPCCDKQ GVKKGPWTPE EDIVLVSYIQ QHGPGNWRAV PANTGLLRCS KSCRLRWTNY  60
LRPGIKRGNF THHEEKMIVH LQALLGNRWA AIASYLPQRT DNDIKNHWNT HLKKRLNNHQ  120
RHSSPAADLT ADPAADTLFT TRGQWERRLQ TDIQMAKQAL SDALSPETSK PPPTLLPVAE  180
SKTSQHQIPG YASSADNIAR WLKEWNKNPP TNNPCRSSSS AVVDSGDGSG GKVNGAGLSE  240
SMDTLMSLEY FESSNNSDGS PETSVFQGES ESMDENEELL PMKLLEEWLH GDSKDYYFTD  300
FTVDEKFKLD NLL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-25141164105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818410.0LN681841.1 Cucumis melo genomic scaffold, anchoredscaffold00011.
GenBankLN7132580.0LN713258.1 Cucumis melo genomic chromosome, chr_4.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008443415.10.0PREDICTED: myb-related protein 306-like
SwissprotP813921e-103MYB06_ANTMA; Myb-related protein 306
TrEMBLA0A0A0LC460.0A0A0A0LC46_CUCSA; Uncharacterized protein
STRINGGLYMA09G37340.11e-110(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101634115
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28910.12e-96myb domain protein 30